missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DYNLT3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £358.00
Specifications
| Antigen | DYNLT3 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DYNLT3 Polyclonal antibody specifically detects DYNLT3 in Human, Mouse samples. It is validated for Western BlotSpecifications
| DYNLT3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 6990 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| dynein, light chain, Tctex-type 3, Protein 91/23, RP3, T-complex-associated testis-expressed 1-like, t-complex-associated-testis-expressed 1-like, TCTE1Ldynein light chain Tctex-type 3, TCTE1XL, TCTEX1L | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 9-99 of human DYNLT3 (NP_006511.1). DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title