missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dynein light chain 4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | Dynein light chain 4 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18695890
|
Novus Biologicals
NBP2-92068-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18686550
|
Novus Biologicals
NBP2-92068-0.1ml |
0.1 mL |
£359.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Dynein light chain 4 Polyclonal antibody specifically detects Dynein light chain 4 in Mouse, Rat samples. It is validated for Western BlotSpecifications
| Dynein light chain 4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Neurodegeneration, Neuroscience, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 10126 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| dJ327J16, dynein light chain 4, axonemal, dynein light chain, outer arm 4, dynein, axonemal, light 4, dynein, axonemal, light chain 4, dynein, axonemal, light polypeptide 4, PIG27, proliferation-inducing gene 27, proliferation-inducing protein 27 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human DNAL4 (NP_005731.1). MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title