missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dynactin Subunit 1/DCTN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£317.00 - £530.00
Specifications
| Antigen | Dynactin Subunit 1/DCTN1 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18656374
|
Novus Biologicals
NBP3-21351-25ul |
25 μg |
£317.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18622785
|
Novus Biologicals
NBP3-21351-100ul |
100 μg |
£530.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Dynactin Subunit 1/DCTN1 Polyclonal antibody specifically detects Dynactin Subunit 1/DCTN1 in Human samples. It is validated for ImmunofluorescenceSpecifications
| Dynactin Subunit 1/DCTN1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, 40% glycerol | |
| 1639 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| dynactin 1, dynactin 1 (p150, Glued (Drosophila) homolog), dynactin subunit 1, glued homolog, Drosophila), p135, p150 Glued (Drosophila) homolog, p150-glued | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title