DUSP19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-84041

Product Code. 18266198

Description

DUSP19 Polyclonal specifically detects DUSP19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DUSP19
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: dual specificity phosphatase 19, Dual specificity phosphatase TS-DSP1, dual specificity protein phosphatase 19, DUSP17SAPK pathway-regulating phosphatase 1, EC 3.1.3.16, EC 3.1.3.48, LMWDSP3, LMW-DSP3, Low molecular weight dual specificity phosphatase 3, Protein phosphatase SKRP1, SKRP1MGC138210, Stress-activated protein kinase pathway-regulating phosphatase 1, TS-DSP1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 142679
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DUSP19
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only