DUSP11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-68919

Product Code. 18223901

Description

DUSP11 Polyclonal specifically detects DUSP11 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: DUSP11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dual specificity phosphatase 11 (RNA/RNP complex 1-interacting), Dual specificity protein phosphatase 11, EC 3.1.3.-, Phosphatase that interacts with RNA/RNP complex 1, PIR1RNA/RNP complex-interacting phosphatase, RNA/RNP complex-1-interacting phosphatase, serine/threonine specific protein phosphatase
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6NXK5
• Gene Symbols: DUSP11
• Immunogen: Synthetic peptides corresponding to Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)) The peptide sequence was selected from the N terminal of Dusp11. Peptide sequence GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLII The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8446
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only