missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DTX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £514.00
Specifications
| Antigen | DTX2 |
|---|---|
| Dilution | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18424722
|
Novus Biologicals
NBP2-13941-25ul |
25ul |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18057365
|
Novus Biologicals
NBP2-13941 |
0.1 mL |
£514.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DTX2 Polyclonal specifically detects DTX2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| DTX2 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 113878 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: YPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| deltex (Drosophila) homolog 2, deltex homolog 2 (Drosophila), Deltex2, hDTX2, MGC71098, protein deltex-2, RING finger protein 58, RNF58KIAA1528deltex2, zinc ion binding protein | |
| DTX2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title