missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DTW Domain Containing 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
DTW Domain Containing 2 Polyclonal specifically detects DTW Domain Containing 2 in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | DTW Domain Containing 2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | DTW Domain-Containing Protein 2, DTWD2 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse DTW Domain Containing 2 (NP_001164431.1). Peptide sequence LQALCSFQLQHGAQIRLSKEYLLRNGLYPKPMPKNKRKLRKMELLMNSVK |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?