DSN1 Antibody (2A7), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00079980-M01

Product Code. 18497538

Description

DSN1 Monoclonal antibody specifically detects DSN1 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA

Specifications

• Antigen: DSN1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: C20orf172, chromosome 20 open reading frame 172, dJ469A13.2, DSN1, MIND kinetochore complex component, homolog (S. cerevisiae), FLJ13346, hKNL-3, kinetochore null 3 homolog, kinetochore-associated protein DSN1 homolog, KNL3, MIS13MGC32987
• Immunogen: C20orf172 (NP_079194.2, 257 a.a. ∽ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSC
• Quantity: 0.1 mg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, ELISA, Sandwich ELISA
• Clone: 2A7
• Dilution: Western Blot 1:500, ELISA, Sandwich ELISA
• Gene Accession No.: NP_079194
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79980
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ