missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
DSCR6 Polyclonal specifically detects DSCR6 in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | DSCR6 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Down syndrome critical region gene 6, protein ripply3, RIPPLY3Down syndrome critical region protein 6 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse DSCR6 (NP_573492.2). Peptide sequence ESWGDQHTSGSKGAFGFQHPVRLYLPVSKRQEYLQSSGEKVLASFPVQAT |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?