missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DRG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DRG1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DRG1 Polyclonal specifically detects DRG1 in Human samples. It is validated for Western Blot.Specifications
| DRG1 | |
| Polyclonal | |
| Rabbit | |
| developmentally regulated GTP binding protein 1, developmentally regulated GTP-binding protein 1, developmentally-regulated GTP-binding protein 1, DKFZp434N1827, DRG-1, NEDD3, NEDD-3, Neural precursor cell expressed developmentally down-regulated protein 3, neural precursor cell expressed, developmentally down-regulated 3 | |
| DRG1 | |
| IgG | |
| 26 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 4733 | |
| Synthetic peptides corresponding to DRG1(developmentally regulated GTP binding protein 1) The peptide sequence was selected from the middle region of DRG1. Peptide sequence VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title