missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DPPIV/CD26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21319-25ul
This item is not returnable.
View return policy
Description
DPPIV/CD26 Polyclonal antibody specifically detects DPPIV/CD26 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| DPPIV/CD26 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ADABP, ADCP-2, ADCP2DPP IV, Adenosine deaminase complexing protein 2TP103, CD26 antigen, CD26T-cell activation antigen CD26, dipeptidyl peptidase 4, Dipeptidyl peptidase IV, dipeptidylpeptidase 4, dipeptidyl-peptidase 4, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2), DPPIV, EC 3.4.14.5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP | |
| 25 μg | |
| Adaptive Immunity, Cellular Markers, GPCR, Immunology | |
| 1803 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction