DPPA5/ESG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17834-25UL

Product Code. 18356396

Description

DPPA5/ESG1 Polyclonal antibody specifically detects DPPA5/ESG1 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: DPPA5/ESG1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: developmental pluripotency associated 5, developmental pluripotency-associated 5 protein, embryonal stem cell specific gene 1, Embryonal stem cell-specific gene 1 protein, Esg1, ESG1ESG-1, hDPPA5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS
• Quantity: 25 μg
• Research Discipline: Stem Cells
• Gene ID (Entrez): 340168
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified