missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DPPA5/ESG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

DPPA5/ESG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18356396
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18356396 25 μg 25µL
18387263 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18356396 Supplier Novus Biologicals Supplier No. NBP31783425UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

DPPA5/ESG1 Polyclonal antibody specifically detects DPPA5/ESG1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen DPPA5/ESG1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias developmental pluripotency associated 5, developmental pluripotency-associated 5 protein, embryonal stem cell specific gene 1, Embryonal stem cell-specific gene 1 protein, Esg1, ESG1ESG-1, hDPPA5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 340168
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.