missing translation for 'onlineSavingsMsg'
Learn More

DPP8 Antibody (1B10), Novus Biologicals™

Product Code. 18324989 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18324989 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18324989 Supplier Novus Biologicals Supplier No. H00054878M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

DPP8 Monoclonal antibody specifically detects DPP8 in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen DPP8
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1B10
Conjugate Unconjugated
Dilution ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_932065
Gene Alias dipeptidyl peptidase 8, Dipeptidyl peptidase IV-related protein 1, dipeptidyl peptidase IV-related protein-1, dipeptidylpeptidase 8, dipeptidyl-peptidase 8, DP8Dipeptidyl peptidase VIII, DPP VIII, DPRP-1, DPRP1Prolyl dipeptidase DPP8, EC 3.4.14.5, FLJ14920, FLJ20283, MGC26191, MSTP141
Host Species Mouse
Immunogen DPP8 (NP_932065.1, 161 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54878
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.