DP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10877-100UL

Product Code. 18358735

Description

DP1 Polyclonal specifically detects DP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DP1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
• Gene Alias: DP1E2F dimerization partner 1, DRTF1Dp-1, DRTF1-polypeptide 1, E2F-related transcription factor, transcription factor Dp-1
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DP1 (NP_009042). Peptide sequence VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN
• Quantity: 100 μg
• Research Discipline: Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 7027
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified