missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Doublecortin Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33429-20ul
This item is not returnable.
View return policy
Description
Doublecortin Monoclonal antibody specifically detects Doublecortin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Doublecortin | |
| Monoclonal | |
| Western Blot 1:2000 - 1:8000, ELISA Recommended starting concentration is 1 μg/mL | |
| doublecortin, Doublin, FLJ51296, Lissencephalin-X, Lis-X, X-linked (doublecortin) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 265-365 of human Doublecortin (NP_835365.1).,, Sequence:, SLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSLGDSM | |
| 20 μL | |
| Neuroscience, Phospho Specific, Signal Transduction | |
| 1641 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction