missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DOK7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68794
This item is not returnable.
View return policy
Description
DOK7 Polyclonal antibody specifically detects DOK7 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| DOK7 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| C4orf25chromosome 4 open reading frame 25, CMS1B, docking protein 7, Dok-7, Downstream of tyrosine kinase 7, FLJ33718, FLJ39137, FLJ90556, protein Dok-7 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TLQLEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQE | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 285489 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction