DOK5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-39051

Product Code. 18140729

Description

DOK5 Polyclonal specifically detects DOK5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DOK5
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9P104
• Gene Symbols: DOK5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EQHERLLQSVKNSMLQMKMSERAASLSTMVPLPRSAY
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C20orf180, chromosome 20 open reading frame 180, dJ805C22.1, docking protein 5, Downstream of tyrosine kinase 5, Insulin receptor substrate 6, IRS6, IRS-6, MGC16926
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55816
• Target Species: Human
• Isotype: IgG