missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18607565

DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - IHC-Prediluted, R&D Systems™

Product Code. 18607565 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
7 mL
Unit Size:
7mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Quantity Förpackningsstorlek
18607565 7 mL 7mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18607565 Leverantör Novus Biologicals Leverantörsnummer NBP244381
 Restricted Item
Estimated Shipment: 26-11-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen DOG1/TMEM16A
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone DG1/447 + DOG-1.1
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 0.25 - 0.5 μg/mL
Formulation 10 mM PBS with 0.05% BSA
Gene Alias ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Host Species Mouse
Immunogen Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Purification Method Protein A or G purified
Quantity 7 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55107
Target Species Human
Content And Storage Store at 4°C.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Product Line Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.