missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DOC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DOC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DOC1 Polyclonal specifically detects DOC1 in Human samples. It is validated for Western Blot.Specifications
| DOC1 | |
| Polyclonal | |
| Rabbit | |
| 90 kDa GPBP-interacting protein, downregulated in ovarian cancer 1 81 kDa isoform, filamin A interacting protein 1-like, GIP130a, GIP130b, GIP130c | |
| FILIP1L | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 11259 | |
| Synthetic peptides corresponding to FILIP1L(filamin A interacting protein 1-like) The peptide sequence was selected from the middle region of FILIP1L. Peptide sequence KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title