DNTTIP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38710

Product Code. 18162589

Description

DNTTIP2 Polyclonal specifically detects DNTTIP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DNTTIP2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: Q5QJE6
• Gene Symbols: DNTTIP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DEGKEINEKSSQLKNLSELQDTSLQQLVSQRHSTPQNKNAVSVHSNLNSEAVMKSLTQTFATVEVGRWNNNKKSPIKASDLTKFGDCGGSDD
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: acidic 82 kDa protein mRNA, deoxynucleotidyltransferase terminal-interacting protein 2, deoxynucleotidyltransferase, terminal, interacting protein 2, ERBP, estrogen receptor binding protein, FCF2, FLJ98849, HSU15552, LPTS-interacting protein 2, LPTS-RP2, MGC163494, TdIF2, tdT-interacting factor 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 30836
• Target Species: Human
• Isotype: IgG