missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNMT1 Rabbit anti-Human, Mouse, Rat, Clone: 8E3H1, Novus Biologicals™
Description
DNMT1 Monoclonal antibody specifically detects DNMT1 in Human, Mouse, Rat samples. It is validated for Western Blot, ChIP assay, Immunofluorescence, Immunoprecipitation, KnockDown
Specifications
Specifications
| Antigen | DNMT1 |
| Applications | ChIP Assay, Immunofluorescence, Immunoprecipitation, KnockDown |
| Classification | Monoclonal |
| Clone | 8E3H1 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, Chromatin Immunoprecipitation 1:50 - 1:200, Immunocytochemistry/Immunofluorescence, Immunoprecipitation 1:500 - 1:1000, Knockout Validated |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | AIM, CXXC9CXXC finger protein 9, CXXC-type zinc finger protein 9, DNA (cytosine-5-)-methyltransferase 1, DNA (cytosine-5)-methyltransferase 1, DNA methyltransferase 1, DNA methyltransferase HsaI, DNA MTase HsaI, DNMT, Dnmt1, EC 2.1.1.37, FLJ16293, m.HsaI, MCMTMGC104992 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1). MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?