missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNHD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00
Specifications
| Antigen | DNHD1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DNHD1 Polyclonal specifically detects DNHD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DNHD1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 144132 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C11orf47, CCDC35, coiled-coil domain containing 35, DKFZp686J0796, DKFZp686N1238, dynein heavy chain domain 1, dynein heavy chain domain-containing protein 1, FLJ00251, FLJ32752, FLJ35709, FLJ39625, FLJ43897, MGC133191 | |
| DNHD1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title