DNASE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18488080	Novus Biologicals NBP1-84999-25ul	25ul
18263267	Novus Biologicals NBP1-84999	0.1 mL

Description

DNASE1 Polyclonal specifically detects DNASE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DNASE1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: deoxyribonuclease IFLJ38093, deoxyribonuclease-1, DKFZp686H0155, DNase I, DNase I, lysosomal, DNL1FLJ44902, Dornase alfa, DRNI, EC 3.1.21.1, human urine deoxyribonuclease I
• Gene Symbols: DNASE1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, DNA Repair, DNA replication Transcription Translation and Splicing
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1773
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YVRPSQWSSIRLWTSPTFQWLIPDSADTTATPTHCAYDRIVVAGMLLRGAVVPDSALPFNFQAAYGLSDQLAQAISDHY
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only