missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | DNAJC22 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18266724
|
Novus Biologicals
NBP2-58463 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607978
|
Novus Biologicals
NBP2-58463-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAJC22 Polyclonal specifically detects DNAJC22 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| DNAJC22 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 79962 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| DnaJ (Hsp40) homolog, subfamily C, member 22, dnaJ homolog subfamily C member 22, FLJ13236, wurst homolog, wus | |
| DNAJC22 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title