missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC15 Rabbit anti-Human, Mouse, Rat, Clone: 7D7X7, Novus Biologicals™
Rabbit Monoclonal Antibody
£150.00 - £387.00
Specifications
| Antigen | DNAJC15 |
|---|---|
| Clone | 7D7X7 |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18087443
|
Novus Biologicals
NBP3-16488-20UL |
20 μg |
£150.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18089183
|
Novus Biologicals
NBP3-16488-100UL |
100 μg |
£387.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAJC15 Monoclonal antibody specifically detects DNAJC15 in Human, Mouse, Rat samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| DNAJC15 | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Cell growth-inhibiting gene 22 protein, DnaJ (Hsp40) homolog, subfamily C, member 15, DnaJ (Hsp40) homolog, subfamily D, member 1, DNAJ domain-containing, dnaJ homolog subfamily C member 15, DNAJD1, MCJHSD18, Methylation-controlled J protein | |
| A synthetic peptide corresponding to a sequence within amino acids 70-150 of human DNAJC15 (Q9Y5T4). ETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 7D7X7 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 29103 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title