missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJB4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£342.00 - £470.00
Specifications
| Antigen | DNAJB4 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18488420
|
Novus Biologicals
NBP1-81735-25ul |
25 μL |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18280676
|
Novus Biologicals
NBP1-81735 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAJB4 Polyclonal antibody specifically detects DNAJB4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifications
| DNAJB4 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| DjB4, DnaJ (Hsp40) homolog, subfamily B, member 4, dnaJ homolog subfamily B member 4, DnaJ-like heat shock protein 40, DNAJW, Heat shock 40 kDa protein 1 homolog, Heat shock protein 40 homolog, HLJ1HSP40 homolog, Human liver DnaJ-like protein | |
| DNAJB4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 11080 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title