DNA polymerase sigma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-13728-25ul

Código de producto. 18420282

Descripción

DNA polymerase sigma Polyclonal antibody specifically detects DNA polymerase sigma in Human samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.

Especificaciones

• Antigen: DNA polymerase sigma
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 ug/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 ug/mL
• Gene Alias: DNA polymerase kappa, DNA polymerase sigma, EC 2.7.7.7, LAK-1TUTase 5, PAP associated domain containing 7, POLKTRF41, POLSTUTASE5, polymerase (DNA directed) sigma, polymerase (DNA-directed) sigma, Terminal uridylyltransferase 5, Topoisomerase-related function protein 4-1, TRF4-1LAK1, TRF4PAP-associated domain-containing protein 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11044
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TENT4A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only