missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA polymerase mu Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DNA polymerase mu |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DNA polymerase mu Polyclonal specifically detects DNA polymerase mu in Human samples. It is validated for Western Blot.Specifications
| DNA polymerase mu | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| DNA polymerase mu, DNA-directed DNA/RNA polymerase mu, EC 2.7.7.7, FLJ35482, Pol iota, Pol Mu, polmu, polymerase (DNA directed), mu, polymerase (DNA-directed), mu, Tdt-N, Terminal transferase | |
| POLM | |
| IgG | |
| 55 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NP87 | |
| 27434 | |
| Synthetic peptides corresponding to POLM(polymerase (DNA directed), mu) The peptide sequence was selected from the middle region of POLM (NP_037416). Peptide sequence LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title