DNA Polymerase Kappa Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-57541

Codice prodotto. 18282003

Descrizione

DNA Polymerase Kappa Polyclonal specifically detects DNA Polymerase Kappa in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifica

• Antigen: DNA Polymerase Kappa
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DINB protein, DINPPOLQDINB1EC 2.7.7.7, DNA polymerase kappa, polymerase (DNA directed) kappa
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51426
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: POLK
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVST
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only