missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA Polymerase Kappa Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£154.00 - £434.00
Specifications
| Antigen | DNA Polymerase Kappa |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232107
|
Novus Biologicals
NBP3-36711-100ul |
100 μL |
£434.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228025
|
Novus Biologicals
NBP3-36711-20ul |
20 μL |
£154.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNA Polymerase Kappa Polyclonal antibody specifically detects DNA Polymerase Kappa in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| DNA Polymerase Kappa | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse, Rat | |
| DINB protein, DINPPOLQDINB1EC 2.7.7.7, DNA polymerase kappa, polymerase (DNA directed) kappa | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA Polymerase Kappa (NP_057302.1).,, Sequence:, MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 51426 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title