missing translation for 'onlineSavingsMsg'
Learn More

DNA Polymerase epsilon subunit 3 Antibody, Novus Biologicals™

Product Code. 18386379 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18386379 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18386379 Supplier Novus Biologicals Supplier No. H00054107B02P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

DNA Polymerase epsilon subunit 3 Polyclonal antibody specifically detects DNA Polymerase epsilon subunit 3 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen DNA Polymerase epsilon subunit 3
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Immunocytochemistry/ Immunofluorescence
Formulation PBS (pH 7.4)
Gene Accession No. AAH03166.1
Gene Alias Arsenic-transactivated protein, asTP, CHARAC17arsenic transactivated protein, CHRAC-17, CHRAC17Ybl1, Chromatin accessibility complex 17 kDa protein, DNA polymerase epsilon p17 subunit, DNA polymerase epsilon subunit 3, DNA polymerase epsilon subunit p17, DNA polymerase II subunit 3, EC 2.7.7.7, histone fold protein CHRAC17, HuCHRAC17, p17, polymerase (DNA directed), epsilon 3 (p17 subunit), YBL1
Host Species Mouse
Immunogen POLE3 (AAH03166.1, 1 a.a. - 147 a.a.) full-length human protein. MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline DNA Polymerases
Primary or Secondary Primary
Gene ID (Entrez) 54107
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.