missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DNA Polymerase epsilon subunit 3 Antibody, Novus Biologicals™

DNA Polymerase epsilon subunit 3 Antibody, Novus Biologicals™

Product Code. 18406161 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18406161 0.1 mL 0.10mL
18423122 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18406161 Supplier Novus Biologicals Supplier No. NBP213785

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

DNA Polymerase epsilon subunit 3 Polyclonal antibody specifically detects DNA Polymerase epsilon subunit 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen DNA Polymerase epsilon subunit 3
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias Arsenic-transactivated protein, asTP, CHARAC17arsenic transactivated protein, CHRAC-17, CHRAC17Ybl1, Chromatin accessibility complex 17 kDa protein, DNA polymerase epsilon p17 subunit, DNA polymerase epsilon subunit 3, DNA polymerase epsilon subunit p17, DNA polymerase II subunit 3, EC 2.7.7.7, histone fold protein CHRAC17, HuCHRAC17, p17, polymerase (DNA directed), epsilon 3 (p17 subunit), YBL1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Chromatin Research, DNA Polymerases, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 54107
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.