missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA Ligase I Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | DNA Ligase I |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18288072
|
Novus Biologicals
NBP2-55992 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18657926
|
Novus Biologicals
NBP2-55992-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNA Ligase I Polyclonal specifically detects DNA Ligase I in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DNA Ligase I | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Base Excision Repair, Cancer, DNA Repair, Nucleotide Excision Repair, Tumor Suppressors | |
| DNA ligase 1, DNA ligase I, EC 6.5.1.1, ligase I, DNA, ATP-dependent, MGC117397, MGC130025, Polydeoxyribonucleotide synthase [ATP] 1, polydeoxyribonucleotide synthase ATP 1 | |
| LIG1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 3978 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title