DMRTB1, Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse Polyclonal Antibody

Brand:  Abnova H00063948-B02P.50ug

Product Code. 16103009

Description

Sequence: MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD

Specifications

• Antigen: DMRTB1
• Classification: Polyclonal
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: BC029566.1
• Gene Symbols: DMRTB1
• Immunogen: DMRTB1 (AAH29566.1, 1 a.a. ∼ 189 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 63948
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Gene: DMRT-like family B with proline-rich C-terminal, 1
• Gene Alias: -
• Host Species: Mouse
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody