missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18377559

DLEU1 Antibody (2C2), Novus Biologicals™

Product Code. 18377559 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18377559 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18377559 Supplier Novus Biologicals Supplier No. H00010301M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

DLEU1 Monoclonal antibody specifically detects DLEU1 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen DLEU1
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 2C2
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. BC020692
Gene Alias BCMS, Deleted in lymphocytic leukemia 1, deleted in lymphocytic leukemia 1 (non-protein coding), deleted in lymphocytic leukemia, 1, DLB1, DLEU2, HBV XAg-transactivated protein 6, HBV X-transactivated gene 6 protein, LEU1LEU2, NCRNA00021, XTP6MGC22430
Host Species Mouse
Immunogen DLEU1 (AAH20692, 1 a.a. ~ 78 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 10301
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.