missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dishevelled-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17787-100UL
This item is not returnable.
View return policy
Description
Dishevelled-1 Polyclonal antibody specifically detects Dishevelled-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Dishevelled-1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| dishevelled 1 (homologous to Drosophila dsh), dishevelled, dsh homolog 1 (Drosophila), Dishevelled-1, DSH homolog 1, DVL, DVL1L1, MGC54245, segment polarity protein dishevelled homolog DVL-1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS | |
| 100 μg | |
| Signal Transduction, Wnt Signaling Pathway | |
| 1855 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction