missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DIS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | DIS3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18287302
|
Novus Biologicals
NBP2-55359 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18620219
|
Novus Biologicals
NBP2-55359-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DIS3 Polyclonal specifically detects DIS3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DIS3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 2810028N01Rik, DIS3 mitotic control homolog (S. cerevisiae), dis3p, DKFZp667L1817, EC 3.1.13, EC 3.1.13.-, EC 3.1.26.-, EXOSC11, exosome complex exonuclease RRP44, exosome component 11, FLJ10484, KIAA1008RP11-342J4.3, MGC33035, mitotic control protein dis3 homolog, Protein DIS3 homolog, Ribosomal RNA-processing protein 44, RRP44bA555G22.1 | |
| DIS3 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 22894 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSSNLCSLKCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDSANMNDDITTSLRGLNKLAKILKKRRIEKGALTLSSPEV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title