DIRAS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58888

Product Code. 18236251

Description

DIRAS1 Polyclonal specifically detects DIRAS1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DIRAS1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DIRAS family, GTP-binding RAS-like 1, Di-Ras1, Distinct subgroup of the Ras family member 1, GBTS1Small GTP-binding tumor suppressor 1, GTP-binding protein Di-Ras1, Ras-related inhibitor of cell growth, Rig, RIGFLJ42681
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95057
• Gene Symbols: DIRAS1
• Immunogen: Synthetic peptides corresponding to DIRAS1(DIRAS family, GTP-binding RAS-like 1) The peptide sequence was selected from the N terminal of DIRAS1. Peptide sequence PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 148252
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.