missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DIRAS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DIRAS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DIRAS1 Polyclonal specifically detects DIRAS1 in Human samples. It is validated for Western Blot.Specifications
| DIRAS1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| DIRAS family, GTP-binding RAS-like 1, Di-Ras1, Distinct subgroup of the Ras family member 1, GBTS1Small GTP-binding tumor suppressor 1, GTP-binding protein Di-Ras1, Ras-related inhibitor of cell growth, Rig, RIGFLJ42681 | |
| DIRAS1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O95057 | |
| 148252 | |
| Synthetic peptides corresponding to DIRAS1(DIRAS family, GTP-binding RAS-like 1) The peptide sequence was selected from the middle region of DIRAS1. Peptide sequence KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title