missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DIO3 Antibody - BSA Free, Novus Biologicals™

DIO3 Antibody - BSA Free, Novus Biologicals™

Product Code. 18671822 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.01mL
0.02mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18671822 0.1 mL 0.01mL
18633612 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18671822 Supplier Novus Biologicals Supplier No. NBP2924820.1ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

DIO3 Polyclonal antibody specifically detects DIO3 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen DIO3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias 5DIII, D3, deiodinase, iodothyronine, type III, DIOIII, EC 1.97.1, EC 1.97.1.11, ITDI3, placental type, thyroxine deiodinase type III (selenoprotein), Type 3 DI, type 3 iodothyronine selenodeiodinase, type III iodothyronine deiodinase, type-III 5' deiodinase, Type-III 5'-deiodinase
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human DIO3 (NP_001353.4). HFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTU
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Growth and Development, Lipid and Metabolism, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1735
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.