missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
DIO3 Polyclonal antibody specifically detects DIO3 in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | DIO3 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | 5DIII, D3, deiodinase, iodothyronine, type III, DIOIII, EC 1.97.1, EC 1.97.1.11, ITDI3, placental type, thyroxine deiodinase type III (selenoprotein), Type 3 DI, type 3 iodothyronine selenodeiodinase, type III iodothyronine deiodinase, type-III 5' deiodinase, Type-III 5'-deiodinase |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human DIO3 (NP_001353.4). HFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTU |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?