DIO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56543

Product Code. 18222331

Description

DIO2 Polyclonal specifically detects DIO2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DIO2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 5DII, D2, deiodinase, iodothyronine, type II, DIOII, EC 1.97.1, EC 1.97.1.10, ITDI2, SelY, TXDI2thyroxine deiodinase, type II, Type 2 DI, type 2 iodothyronine deiodinase, type II iodothyronine deiodinase, type-II 5'deiodinase, Type-II 5'-deiodinase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1734
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DIO2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERP
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only