missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Dihydrolipoamide Dehydrogenase/DLD Antibody, Novus Biologicals™

Dihydrolipoamide Dehydrogenase/DLD Antibody, Novus Biologicals™

Product Code. 18433122 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Förpackningsstorlek:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Quantity unitSize
18433122 25 μL 25µL
18467561 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18433122 Leverantör Novus Biologicals Leverantörsnummer NBP21392625ul

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

Dihydrolipoamide Dehydrogenase/DLD Polyclonal antibody specifically detects Dihydrolipoamide Dehydrogenase/DLD in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen Dihydrolipoamide Dehydrogenase/DLD
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias 2-oxo-glutarate complex, branched chain keto acid dehydrogenase complex), branched chain keto acid dehydrogenase complex, dihydrolipoamide dehydrogenase (E3 component of pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenasemitochondrial, DLDH, E3, E3 component of pyruvate dehydrogenase complex, 2-oxo-glutarate complex, EC 1.8.1, EC 1.8.1.4, GCSL, Glycine cleavage system L protein, glycine cleavage system protein L, lipoamide dehydrogenase, lipoamide reductase, lipoyl dehydrogenase
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVK
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Diabetes Research, Mitochondrial Markers, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 1738
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.