DHRS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49605

Product Code. 18668816

Description

DHRS2 Polyclonal antibody specifically detects DHRS2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: DHRS2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: dehydrogenase/reductase (SDR family) member 2, dehydrogenase/reductase member 2, dehydrogenase/reductase SDR family member 2, Dicarbonyl reductase HEP27, EC 1.1.1.-, EC 1.1.1.184, HEP27, Protein D, SDR25C1, short chain dehydrogenase/reductase family 25C, member 1, short-chain alcohol dehydrogenase family member
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10202
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG