missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DGCR6L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DGCR6L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DGCR6L Polyclonal specifically detects DGCR6L in Human samples. It is validated for Western Blot.Specifications
| DGCR6L | |
| Polyclonal | |
| Rabbit | |
| NP_150282 | |
| 85359 | |
| Synthetic peptide directed towards the C terminal of human DGCR6LThe immunogen for this antibody is DGCR6L. Peptide sequence QQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DiGeorge syndrome critical region 6-like protein, DiGeorge syndrome critical region gene 6 like, DiGeorge syndrome critical region gene 6-like, FLJ10666, protein DGCR6L | |
| DGCR6L | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title