missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DGCR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DGCR2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DGCR2 Polyclonal specifically detects DGCR2 in Human samples. It is validated for Western Blot.Specifications
| DGCR2 | |
| Polyclonal | |
| Rabbit | |
| P98153 | |
| 9993 | |
| Synthetic peptides corresponding to DGCR2(DiGeorge syndrome critical region gene 2) The peptide sequence was selected from the N terminal of DGCR2. Peptide sequence MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DGS-C, DiGeorge syndrome critical region gene 2, IDDDKFZp686I1730, integral membrane protein deleted in DiGeorge syndrome, integral membrane protein DGCR2/IDD, KIAA0163DiGeorge syndrome critical region protein 2, LAN, SEZ-12 | |
| DGCR2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title