DFF45/ICAD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-85249-25ul

Product Code. 18460172

Description

DFF45/ICAD Polyclonal antibody specifically detects DFF45/ICAD in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: DFF45/ICAD
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DFF1DNA fragmentation factor 45 kDa subunit, DFF45DNA fragmentation factor subunit alpha, DFF-45DNA fragmentation factor, 45 kD, alpha polypeptide, DNA fragmentation factor, 45kDa, alpha polypeptide, ICAD, Inhibitor of CAD
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLP
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Tumor Suppressors
• Gene ID (Entrez): 1676
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified