missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Desmin Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£180.00 - £409.00
Specifications
| Antigen | Desmin |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:1000 - 1:5000 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232483
|
Novus Biologicals
NBP3-33531-100ul |
100 μL |
£409.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231027
|
Novus Biologicals
NBP3-33531-20ul |
20 μL |
£180.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Desmin Monoclonal antibody specifically detects Desmin in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| Desmin | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Phospho Specific | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 1674 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:1000 - 1:5000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CMD1IFLJ41013, CSM1, CSM2, desmin, FLJ12025, FLJ39719, FLJ41793, intermediate filament protein | |
| A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Desmin (P17661).,, Sequence:, EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title