missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Derlin 1 Antibody - BSA Free, Novus Biologicals™

Derlin 1 Antibody - BSA Free, Novus Biologicals™

Product Code. p-200061939 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18653292 0.02 mL 0.02mL
18693782 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18653292 Supplier Novus Biologicals Supplier No. NBP2925530.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Derlin 1 Polyclonal antibody specifically detects Derlin 1 in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Derlin 1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias DER-1, DER1Degradation in endoplasmic reticulum protein 1, Der1-like domain family, member 1, Der1-like protein 1, derlin-1, DERtrin-1, FLJ13784, FLJ42092, MGC3067, PRO2577
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 182-251 of human DERL1 (NP_077271.1). LYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline ER Markers, Immunology, Lipid and Metabolism, Protein Turnover, Signal Transduction, Unfolded Protein Response
Primary or Secondary Primary
Gene ID (Entrez) 79139
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.