missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Derlin 1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £358.00
Specifications
| Antigen | Derlin 1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Derlin 1 Polyclonal antibody specifically detects Derlin 1 in Human, Mouse samples. It is validated for Western BlotSpecifications
| Derlin 1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| ER Markers, Immunology, Lipid and Metabolism, Protein Turnover, Signal Transduction, Unfolded Protein Response | |
| PBS with 50% glycerol, pH7.3. | |
| 79139 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| DER-1, DER1Degradation in endoplasmic reticulum protein 1, Der1-like domain family, member 1, Der1-like protein 1, derlin-1, DERtrin-1, FLJ13784, FLJ42092, MGC3067, PRO2577 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 182-251 of human DERL1 (NP_077271.1). LYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title